PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00006.1.g00850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 340aa    MW: 38216.7 Da    PI: 9.5347
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00006.1.g00850.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-17118165148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd++lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Zmw_sc00006.1.g00850.1.am.mk 118 KGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 165
                                   79******************************99************97 PP

2Myb_DNA-binding32.12.7e-10171208147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg++T+eEdel+++++ + G++        ++ gRt++++k++w+++
  Zmw_sc00006.1.g00850.1.am.mk 171 RGNFTEEEDELIIKLHSLVGNK--------LP-GRTDNEIKNYWNTH 208
                                   89******************99........**.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-23109168IPR009057Homeodomain-like
PROSITE profilePS5129422.77113169IPR017930Myb domain
SMARTSM007171.9E-13117167IPR001005SANT/Myb domain
SuperFamilySSF466898.99E-24117205IPR009057Homeodomain-like
PfamPF002497.1E-15118165IPR001005SANT/Myb domain
CDDcd001671.86E-10120165No hitNo description
Gene3DG3DSA:1.10.10.604.9E-18169213IPR009057Homeodomain-like
PROSITE profilePS5129416.687170213IPR017930Myb domain
SMARTSM007171.5E-8170211IPR001005SANT/Myb domain
PfamPF002492.2E-8171208IPR001005SANT/Myb domain
CDDcd001674.67E-8173209No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MEWSSHTQLA RASLAYLTSH LPEVPFHGRG PLSPLGDLPI QSSAYKIQRR FTHRSLASQQ  60
HQQQQPALPC PALPCSAAQS TESPGKESGG KRKPRKHHHR PCIVMGRSPC CEKAHTNKGA  120
WTKEEDDRLV AYIKAHGEGC WRSLPKAAGL LRCGKSCRLR WINYLRPDLK RGNFTEEEDE  180
LIIKLHSLVG NKLPGRTDNE IKNYWNTHIR RKLLSRGIDP VTHRPINEHA SNITISFEAA  240
RDDKGAVFRR EEQKVAAAIS RHEPPSHGDW GQGKPHKCPD LNLDLCISPP CQDEPMKPVK  300
REAGLCFSCS LGLPKSTDCK CSNFLGLRTA MLDFRSLEMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-2311721326128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957488.11e-149PREDICTED: myb-related protein Hv1
SwissprotP200261e-132MYB1_HORVU; Myb-related protein Hv1
TrEMBLA0A0A9D5311e-152A0A0A9D531_ARUDO; Myb31
STRINGSi030943m1e-148(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448